PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030494
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 466aa    MW: 51496.1 Da    PI: 5.2864
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030494genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.5e-143579348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W+ eEd++l + + ++G+++W+ Ia++++  +t  qc+ rw++yl
      Lus10030494 35 SWSSEEDDILRQQISLHGTENWAIIASKFN-DKTTRQCRRRWFTYL 79
                     6*****************************.*************97 PP

2Myb_DNA-binding44.43.8e-1485128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd+ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
      Lus10030494  85 KGGWSPEEDLLLCEAQRIFGNR-WTEIAKVVS-GRTDNAVKNRFTT 128
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4642879IPR017930Myb domain
SMARTSM007171.5E-123281IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-2533126IPR009057Homeodomain-like
CDDcd001675.02E-123579No hitNo description
PfamPF139214.7E-153695No hitNo description
Gene3DG3DSA:1.10.10.603.7E-203686IPR009057Homeodomain-like
PROSITE profilePS5129420.80680134IPR017930Myb domain
SMARTSM007176.4E-1584132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1987133IPR009057Homeodomain-like
CDDcd001676.86E-1188129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MEEDKKKKMM INGGGGGGGS GSEESTKKKE RHIVSWSSEE DDILRQQISL HGTENWAIIA  60
SKFNDKTTRQ CRRRWFTYLN SDFKKGGWSP EEDLLLCEAQ RIFGNRWTEI AKVVSGRTDN  120
AVKNRFTTLC KKRAKYEALA KENEKGGCIN ANNKRVLLDR KLNAAGSTEN ATAAKRIRRS  180
HIPSRMENQN FGDRSHPKSR TQQLRPPFMV LPPEVHKVNG GSQPPVDNEN DISSDELLST  240
LASKVNSEST DQSLEHAWKV LQNFLKSGKG DEVTSYALPD TDFQLEDFKD LMEDLSSSDG  300
SHSSWRQPDL YEASPASSEF SSGSSLISYS APDATEQPQG EIDMLQNDIE TDLQIVPIEG  360
QNGIGECDNK IVSDDNIAEG DLFPSFNEQT SDGIVVSASS NTKFGSPHQV TPLFGSLAVG  420
IPSPQFSESE RRFLLKTLGV ESPFANPTTN TSQQPPCKRV LLQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-243613310107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067595.10.0PREDICTED: uncharacterized protein LOC105630404 isoform X1
TrEMBLA0A067LAN90.0A0A067LAN9_JATCU; MYB family protein
STRINGPOPTR_0010s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-150myb domain protein 88